PC Games

Rune

1 Star2 Stars3 Stars4 Stars5 Stars (No Ratings Yet)
Loading...

Rune is an exhilarating action-adventure game that transports players to a mythical world filled with epic battles and ancient mysteries. As a fearless Viking warrior, you must navigate treacherous landscapes, battle fierce enemies, and uncover the secrets of the runic powers that lie dormant within you.

Immerse yourself in a richly detailed world inspired by Norse mythology, where gods and monsters roam the land and ancient ruins hold the key to unlocking your true potential. With stunning graphics and immersive gameplay, Rune will challenge you to harness the power of the runes to overcome your enemies and fulfill your destiny as a legendary hero.

Whether you prefer to wield a mighty axe in close combat or rain down destruction from afar with powerful magic, Rune offers a variety of playstyles to suit every warrior’s taste. With a gripping storyline, challenging quests, and intense boss battles, this game will keep you on the edge of your seat as you fight for glory and honor in the world of Rune.

So gather your courage, sharpen your blade, and prepare to embark on an unforgettable adventure in the world of Rune. Are you ready to become a legend?

Rune Game Cheats, Tips, Codes, Hints and Tricks

Cheat :

Cheat mode:Note: This procedure involves editing a game file; create a backup copy of the file before proceeding. Use a text editor to edit the “user.ini” file in the game folder. Search for the “G=” and “T=” entries and change them to “G=God” and “T=CheatPlease”. Begin game play, press T to enable cheat mode, then press G to enable God mode. Note: The keys must be pressed again after each new level is started. Alternately, press [Tab], type cheatplease then enter one of the following codes.Effect Code Flight mode fly Disable flight and no clipping modes walk Spawn rune summon runeofpower No clipping mode ghost Level select leveltravel or open

Advance to level with acquired items switchcooplevel

Spawn indicated item summon Disable all non-player characters playersonly Kill all enemies killpawns Display frame rate stat fps Toggle full screen mode togglefullscreen First person view behindview 0 Invisible to enemies invisible Advanced options preferences Unlimited air when underwater amphibious Item names:Use one of the following entries with the summon code. Note: This also includes special effects that can be started. alricberserkerbaracudabeetleconrackcuttlecrowbabycrabgiantcrabdarkvikingdarkvikingsnowdarkwarriordwarfundergrounddwarfwoodlanddwarf2woodlandsmalldwarfwoodlandbigdwarfmechdwarfwaradwarfwarbdwarfwarcdwarfwarddwarfwaredwarfwarfdwarfbloackeldergoblingoblincrazygoblinfemalegoblinmohawkgoblinwarriorgoblinweaklingeeljarljellyfishkarllizardlokilokiheadlokibustlokiguardmanowarmanowarbabyodinodinheadsarkaxesarkswordsarkhammersarkspawnsarkconracksigurdsnowbeastsnowbeastchainedspiderbotstoneguardseabirdsventubestrikerbabytubestrikerulftrainingulfwolfgarzombiezombie2dealiefishschoolplayeralricplayerberserkerplayerconrackplayerdarkvikingplayerdarwarriorplayerelderpalyerkarlplayerlokiguardplayersarkaxeplayersarkconrackplayersarkhammerplayersarkspawnplayersarkswordplayersigurdplayersvenplayerulfplayervalkyrieplayerwolfgarplayerzombieplayerzombie2ragnarragnarflightragnarsnowsarkragnarshipwreckragnartownragnarrainsnowfirehotbowlbenchbonebridgebigbonebridgesmallgonglegomeat1legomeat2legomeat3steinheadsarkheaddarkdwarfboltlavachunkanimaltroughbenchbonebonebridgebigbonebridgesmallbucketburlapsack1burlapsack2burlapsack3chandelierdestroyrockhotbowlicechunklavachunkraftfootbridgegibredmediumgoblinmaskgrainsack1grainsack2grainsack3grainsack4grainsack5hangingchainhelchandelierdrum1drum2drumsidegonghornkegkegwithtap2pelvisbushbush2fruit_treeglowplantglowplant1glowplant2glowplant3glowplant4glowplant5pinetreepinetreebrownpinttreesnowsapplingspongemushroomspongemushroom1spongemushroom2spongemushroom3spongemushroom4spongemushroom5tree1plateribsrockavalancherockavalanchehugerockavalanchelargerockavalanchemedrockavalanchesmallrockhugerocklargerockmediumrocksmallskinskullstatuegoblinstoolstooldwarftarptarpframeseaweeddarkshielddwarfbattleshielddwarfwoodshieldgoblinshieldmagicshieldvikingshieldvikingshieldcrossvikingshield2watterloggedshieldgoblinaxegoblinaxepoweruphandaxesiguardaxevikingaxeboneclubdwarfbattlehammerdwarfworkhammerrustymacetrialpitmacedwarfbattlesworddwarfworkswordromanswordvikingbroadswordvikingshortswordtorchheltorchhealthfruit1healthfruit2legomeat1legomeat2legomeat3lizardsteinruneofhealthruneofpowerruneofpowerrefillruneofstrengthruneofstrengthrefillcarcassbabycrabcarcassdanglercarcassdarkvikingcarcassgiantcrabcarcassgoblincarcassmechdwarfdrownedalricdrownedkarldrownedragnardrownedsvendrownedulfdrownedwolfgardwarfcarcassplayercarcassplayeralriccarcassplayerberserkercarcassplayerconrackcarcassplayerdarkvikingcarcassplayerdarkwarriorcarcassplayereldercarcassplayerkarlcarcassplayerlokiguardcarcassplayerragnarsnowcarcassplayersarkaxecarcassplayersarkconrackcarcassplayersarkhammercarcassplayersarkspawncarcassplayersarkswordcarcassplayershipwreckragnarcarcassplayersigurdcarcassplayersvencarcassplayertownragnarcarcassplayertrialpitragnarcarcassplayerulfcarcassplayervalkyriecarcassplayerwolfgarcarcassplayerzombie2carcassplayerzombiecarcassragnarcarcasssnowbeastchainedcarcasszombiecarcassaxesarkarmberserkerlarmberserkerrarmconracklarmconrackrarmcrabclawcrablegdarkvikinglarmdarkvikingrarmelderarmgoblinlarmgoblinrarmguardlarmguardrarmkarllarmkarlrarmmecharmmechbladearmragnarlarmragnarrarmsarkarmsarkconarmsarkhammerarmsarkragnararmsarkswordarmsigurdlarmsigurdrarmsnowragnararmtownragnararmtrialragnararmttonguewardwarflarmwardwarfrarmwolflarmwolfrarmwomanarmwooddwarflarmwooddwarfrarmzombielarmzombierarmalricheadbeserkerheadconrackheaddarkvikingheadelderheadgoblinbheadgoblincheadgoblindheadgoblineheadgoblinheadguardheadkarlheadragnarheadsarkaxeheadsarkconrackheadsarkhammerheadsarkheadsarkragnarheadsarkswordheadsvenheadtownragnarheadtrialragnarheadulfheadwardwarfaheadwardwarfbheadwardwarfcheadwardwarfdheadwardwarfeheadwardwarffheadwolfheadwomanheadwooddwarfaheadwooddwarfbheadwooddwarfcheadzombieheadblastglowblastradiusblooddripsblooddrips2bloodspotbloodspot2bloodunderwaterbloodwatersurfacecoronareddealielightdebrisfleshdebrisicedebrisstonedebriswoodeatenlegboneeatenlizardemptysteinfruit_corefruit_core2effectskelavalancheswordeffectskelblasteffectskelempathyaxeeffectskelflameswordeffectskelgibaxeeffectskelgroundhammereffectskeliceaxeeffectskellightningswordeffectskelsonicclubeffectskelstonehammereffectskeltrialmaceeffectskelvampirefireradiusfireswordeffectfalshcycleflashfademanowareffectmudglobmudglob2mudsplatodineyeblastprotectionsphereprotspheredamageragnaronbeetlesarkeyeaxesarkeyeconracksarkeyehammersarkeyenonesarkeyeragnarsarkeyeragnarredsarkeyeswordzombieeyesarkeyeflamesarkragnareyeflamesigilsigilflameswordsigillightningswordsonicblastsonicblasthighlightsonicclubeffecttrialpitfirezombieeyeflamedanglerlightdarkdwarfboltlightningswordbeamropeclimbablechainclimbablevinetreeferntreegrowblazeeffectblinkinglightbloodbloodspraygreenbloodspraybloodspurtbluetrailbreathbreathlightbrowndustdarkdwarfblastdarkdwarfexplosiondebrisclouddrippingbloodempathyflashexplosionbigfirepawnfirerespawnfiresmallfiretorchfiretrailfirezombiechangefirefireraysglowplantsparksgrounddustbloodmistsarkblood misthitsparkhiticehitmetalhitweaponhitwoodhitstonehugesplashiceaxeeffectlokieffectmechrocketmechrocketeffectmechrocketexplosionmechrocketsmokemechrockettrailmushroompuffodineffectpoweruprainrainsplashrippledropripplemanowarripplemudrippleripple2runespheresberserkerrunespheresberserker2runesphereshealthrunespherespowerrunespherespower2seekertrailsmokeblacksmokegreysmokesnowsparkswaterfallsplashsteamblaststonehammereffectswipeeffectvampirereplenishwaterfallfogwaterfallsprayweaponhelixhelixempathyzombiebreathtorch Map names:Use one of the following entries with the leveltravel

, open

, or switchcooplevel

codes to advance to the corresponding level or view the indicated FMV sequence. intro (introduction sequence)ragnarvillage (opening sequence)ragnarvillage2sailingship (intermission sequence)sinkingshipsinkingship2deepunder1odindeepunder1odinbvdeepunder3deepunder4hel1hel1ahel1a2hel1bhell2endhel3ahel3bhelliftgoblin1goblin2trialpitbeetlefly (intermission sequence)thorapproachthor1thormap3thormap4athormap4bthormap5athormap5bthormap6lokimountain1mountain2dwarftransdwarf1wwheeldwarfmap2dwarfmap3adwarfmap3bdwarfmap5adwarfmap5bdwarfmap6darkdwarfloki1loki1alokimazeloki2loki3aloki3bvillageruinasgard (ending sequence)


Ghost Mode
During a game, hit the TAB button to access the System Console.
Type ‘CheatPlease’ in the console and hit Enter. Now type
‘Ghost’ and hit return. When you return to the game, you be able
to walk through walls, floors and the ceiling. To return to
normal mode, hit TAB again and enter ‘Walk’.

God Mode
During a game, hit the TAB button to access the System Console.
Type ‘CheatPlease’ in the console and hit Enter. Now type ‘God’
and hit return. When you return to the game, you will be invincible!

Hidden Goodies
In your Rune/System folder you will find a file named “RuneI.int”
open this with notepad, or other such program. scroll down a bit
and you should see 8 lines that read like the following:
”//Object=(Name=RuneI.PlayerSarkSpawn,……”.
Remove the // from all 8 lines and when you start a multiplayer
game you will have 5 new Sark skins, and 3 mutators.

Summon Runes
During the game hit TAB to open the System Console. Type ‘Summon
XXXXX’ (where XXXXX is an item name from below) to spawn the item
into the game.

RuneofPower – Rune Power
RuneofHealth – Health

Summon Sheilds
During the game hit TAB to open the System Console. Type ‘Summon
XXXXX’ (where XXXXX is an item name from below) to spawn the item
into the game.

DarkShield – DarkShield
Vikingshield – Vikingshield
Goblinshield – Goblinshield
Dwarfshield – Dwarvenshield

Summon Weapons
During the game hit TAB to open the System Console. Type ‘Summon
XXXXX’ (where XXXXX is a weapon name from below) to spawn the
weapon into the game.

VikingShortSword – VikingShortSword
RomanSword – RomanSword
VikingBroadSword – VikingBroadSword
DwarfWorkSword – DwarvenWorkSword
DwarfBattleSword – DwarvenBattleSword
HandAxe – HandAxe
GoblinAxe – GoblinAxe
VikingAxe – VikingAxe
SigurdAxe – SigurdsAxe
DwarfBattleAxe – DwarvenBattleAxe
RustyMace – RustyMace
GoblinBoneClub – GoblinBoneClub
TrialPitMace – TrialPitMace
DwarfWorkHammer – DwarvenWorkHammer
DwarfBattleHammer – DwarvenBattleHammer